PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538710.1_FGP016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 677aa    MW: 76542.7 Da    PI: 5.7211
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538710.1_FGP016genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.15.9e-1133036752374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cA+a + +d+++ ++lL+++++++s +gd+ qRla++f++AL+arla+++s++y++l++++ts   + + l+a+kl++ ++P+ k+
  KN538710.1_FGP016 303 TTLLIHCAQAAAIDDHRNSNELLKQIRQRSSAYGDAGQRLAHCFANALEARLAGTGSNIYRSLAAKRTS---VYDILNAFKLYVTACPFKKI 391
                        689**************************************************************9999...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s++   +aIl+a +g +r+Hi+D++i++G+QWp ++q +++Rp+gpps+RiTgv+ p++g   ++ +e+tg+rL+++A+ ++vpfe+++ +a
  KN538710.1_FGP016 392 SNFFSIEAILNASKGVTRLHIVDYGIQYGFQWPIFFQRISKRPGGPPSVRITGVDLPQPGfrPAQLIEATGRRLHDYARMFNVPFEYHA-IA 482
                        ***********************************************************9*999*************************.79 PP

               GRAS 184 krledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                         +++++++e+L++++  +E l+Vn+ +++ +++de v+ +s+r +vLk++++++P+++++   +  +n++ F++rf eal yys+lfd+le+
  KN538710.1_FGP016 483 AKWDTIRVEDLKIDKdkDELLVVNCLFRMRNMMDEMVTDDSPRMQVLKTIRNMNPNLFIHGVVNGTYNAPFFVTRFKEALFYYSSLFDMLET 574
                        9************9999*************************************************************************** PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                        +++r +e+r  +Er l+gre+ nvvaceg+er+er et+++W+ r  +aGFk++pl+++++k+a++ ++k + + + v+e+++++++gWk+r
  KN538710.1_FGP016 575 TASRVDENRLLIERDLFGREALNVVACEGTERVERPETYKQWQVRNIRAGFKQLPLNQETVKKARYKVKKSYHRDFLVDEDNKWMLQGWKGR 666
                        ************************************************************************999***************** PP

               GRAS 366 pLvsvSaWr 374
                         ++++SaW+
  KN538710.1_FGP016 667 IIFALSAWE 675
                        ********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.492276655IPR005202Transcription factor GRAS
PfamPF035142.0E-110303675IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MKGKDTILVK RLFFHGFRFV REKGTVSQEV KGWILFEDSR IMLDSGSYDD VDYGDLFSIP  60
NPPAPHLLNF PLEFFPSNGF NSSADDSYRS PAGMFGSTPS PTSTTTELEN SEDLSESADD  120
AVLAYINQFL LEDEEDESCP GTVTSVEDSA LLAVEKPFVD ILAASQEACQ ENSWIDSCCD  180
FTGNGGLLDM LTNTHATCQP VPCEFEKEKG ECAVHKGRKN PHDDCLLFEE ESRRSKQLAV  240
SEEETVREMF DKVLLCNGEC ELRAPLPAEA RNCGVYVKGS GNKRGRKKGK SGASAEDDAV  300
DLTTLLIHCA QAAAIDDHRN SNELLKQIRQ RSSAYGDAGQ RLAHCFANAL EARLAGTGSN  360
IYRSLAAKRT SVYDILNAFK LYVTACPFKK ISNFFSIEAI LNASKGVTRL HIVDYGIQYG  420
FQWPIFFQRI SKRPGGPPSV RITGVDLPQP GFRPAQLIEA TGRRLHDYAR MFNVPFEYHA  480
IAAKWDTIRV EDLKIDKDKD ELLVVNCLFR MRNMMDEMVT DDSPRMQVLK TIRNMNPNLF  540
IHGVVNGTYN APFFVTRFKE ALFYYSSLFD MLETTASRVD ENRLLIERDL FGREALNVVA  600
CEGTERVERP ETYKQWQVRN IRAGFKQLPL NQETVKKARY KVKKSYHRDF LVDEDNKWML  660
QGWKGRIIFA LSAWEPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-493066748374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1007840.0AK100784.1 Oryza sativa Japonica Group cDNA clone:J023120N07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637021.10.0PREDICTED: scarecrow-like protein 9
SwissprotQ9XE581e-165SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0E0H5C80.0A0A0E0H5C8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PDD20.0A0A0E0PDD2_ORYRU; Uncharacterized protein
TrEMBLQ7XLZ10.0Q7XLZ1_ORYSJ;
STRINGLOC_Os04g50060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138412529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-154SCARECROW-like 14